Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0196800_circ_g.1 |
| ID in PlantcircBase | osa_circ_013649 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 5416863-5417722 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0196800 |
| Parent gene annotation |
Similar to Fumarylacetoacetase (Fragment). (Os02t0196800-01);Sim ilar to Fumarylacetoacetase. (Os02t0196800-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0196800-02:3 Os02t0196800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127641405 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5416927-5416902(+) 5417666-5416888(+) 5417668-5417689(-) |
| Potential amino acid sequence |
MALPFGSNDVCSRYNHRGCTTMITYWKLKPIWVDWGLWPTEDEPTIPCMVHRTKEVGVVSYRDW QKHLCVAHGNKALLLQGLVVTQNRLISISSSKSSFLEGPK*(+) MGTRHFFFKASLSRKTGSSASQVQNQAS*(+) MSDTEMLLPITVGDYTDFFCSVHHARNCGFIFRGPQTPVNPNWFQLPVGYHGRASSVIVSGTDI IRPKGQGHPTGDSRPYFGPSKKLDFELEMLMSRFCVTTRP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |