Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0645200_circ_g.2 |
| ID in PlantcircBase | osa_circ_035004 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 26904100-26904709 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os07g0645200 |
| Parent gene annotation |
Similar to FAT domain-containing protein. (Os07t0645200-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0645200_circ_g.3 |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0645200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111612295 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26904692-26904675(+) 26904125-26904102(-) |
| Potential amino acid sequence |
MHPVYAPVMGLQVSFSNFGVPSLPRLLQATEELCASMS*(+) MKLEVPLQGRILDAFVGKFRTLKRTIPQLLEEGEEGKEHQNLRMKLEVPLQGRILDAFVGKFRT LKRTIPQLLEEGEEGKEHQNLRMKLEVPLQGRILDAFVGKFRTLKRTIPQLLEEGEEGKEHQNL RMKLEVPLQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |