Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0327100_circ_g.2 |
ID in PlantcircBase | osa_circ_014505 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 13181930-13183444 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0327100 |
Parent gene annotation |
Similar to ARL2 G-protein. (Os02t0327100-01) |
Parent gene strand | - |
Alternative splicing | Os02g0327100_circ_g.1 Os02g0327100_circ_g.3 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0327100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.132819703 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13183335-13183438(-) |
Potential amino acid sequence |
MGLLSIIRKIKRKEKEMRILMVGLDNSGKTTIVLKINGEDTGVISPTLGFNIKTIKYHKYSLNI WDIGGQKTIRSYWRNYFEQTDGLVWVVDSSDIRRLDDCRAELHNLLKEEDY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |