Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0327100_circ_g.2 |
| ID in PlantcircBase | osa_circ_014505 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 13181930-13183444 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0327100 |
| Parent gene annotation |
Similar to ARL2 G-protein. (Os02t0327100-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0327100_circ_g.1 Os02g0327100_circ_g.3 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0327100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.132819703 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13183335-13183438(-) |
| Potential amino acid sequence |
MGLLSIIRKIKRKEKEMRILMVGLDNSGKTTIVLKINGEDTGVISPTLGFNIKTIKYHKYSLNI WDIGGQKTIRSYWRNYFEQTDGLVWVVDSSDIRRLDDCRAELHNLLKEEDY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |