Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G16780_circ_g.4 |
| ID in PlantcircBase | ath_circ_002966 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 5743126-5743329 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT1G16780 |
| Parent gene annotation |
Pyrophosphate-energized membrane proton pump 3 |
| Parent gene strand | - |
| Alternative splicing | AT1G16780_circ_g.1 AT1G16780_circ_g.2 AT1G16780_circ_g.3 AT1G16780_circ_g.5 |
| Support reads | 2 |
| Tissues | leaf, aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G16780.2:1 AT1G16780.3:1 AT1G16780.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.478329788 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5743252-5743128(-) |
| Potential amino acid sequence |
MGARTSPIIVFVFVVCIISFMLSVYLTKWVLAKDEGPPEMVQIIRILRNLNVRALSVLLLLSFG GIFYMGARTSPIIVFVFVVCIISFMLSVYLTKWVLAKDEGPPEMVQIIRILRNLNVRALSVLLL LSFGGIFYMGARTSPIIVFVFVVCIISFMLSVYLTKWVLAKDEGPPEMVQIIRILRNLNVRALS VLLLLSFGGIFYMGARTSPIIVFVFVVCIISFMLSVYLTKWVLAKDEGPPEMVQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |