Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G047900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000329 |
| Alias | Chr04:4273920|4274552 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 4273920-4274552 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G047900 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 11 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.004G047900.9:3 Gorai.004G047900.4:3 Gorai.004G047900.6:3 Gorai.004G047900.10:3 Gorai.004G047900.5:3 Gorai.004G047900.2:3 Gorai.004G047900.7:3 Gorai.004G047900.3:3 Gorai.004G047900.8:3 Gorai.004G047900.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.773175053 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4274149-4273921(+) |
| Potential amino acid sequence |
MGVVFSHLEMPLLSEASADNPIIAVIRVFWPMLEKLFRSEHMENSSLSTAACRALSLAIQSSGE HFEMLLPKILDCLSTNFLSFQGHECYIRTD*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |