Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0898300_circ_g.3 |
| ID in PlantcircBase | osa_circ_005261 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 39054176-39054755 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0898300 |
| Parent gene annotation |
Mitochondrial protein, Root development and iron homeostasis (Os 01t0898300-01);Hypothetical conserved gene. (Os01t0898300-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0898300_circ_g.2 Os01g0898300_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0898300-01:2 Os01t0898300-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.13730329 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39054743-39054230(+) 39054745-39054750(-) |
| Potential amino acid sequence |
MNLRFFLVKGHPPEREGQLETSN*(+) MKLNSSQLVLLLSSIWSQAPLEDNSPANFEAMCHTYNIALLCSMTKSSSHAALVRCFQLAFSLR RMSLNQEKS*(-) |
| Sponge-miRNAs | osa-miR2931 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |