Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0110600_circ_g.1 |
ID in PlantcircBase | osa_circ_022895 |
Alias | Os_ciR4412 |
Organism | Oryza sativa |
Position | chr4: 618741-620188 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0110600 |
Parent gene annotation |
Zinc finger, RanBP2-type domain containing protein. (Os04t011060 0-01) |
Parent gene strand | - |
Alternative splicing | Os04g0110600_circ_g.2 Os04g0110600_circ_g.3 |
Support reads | 5/1 |
Tissues | root/shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0110600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_003127 zma_circ_003176 |
PMCS | 0.111358523 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
618767-620178(-) 618814-620185(-) 619884-620178(-) |
Potential amino acid sequence |
MHLEPFATALGTKRLASEELANEWDNKRLNPGNASYPLSTAGTDNLFGGIEQGAGSSNGQTPYS KFDNGNSIALPSGQVSAMPGLIGKGAKWREGDWMCSNCNNHNYASRAFCNSIRN*(-) MARRRLDVQQLQQSQLCISSLLQQH*(-) MPGLIGKGAKWREGDWMCSNCNNHNYASRAFCNSIRN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |