Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0110600_circ_g.1 |
| ID in PlantcircBase | osa_circ_022895 |
| Alias | Os_ciR4412 |
| Organism | Oryza sativa |
| Position | chr4: 618741-620188 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0110600 |
| Parent gene annotation |
Zinc finger, RanBP2-type domain containing protein. (Os04t011060 0-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0110600_circ_g.2 Os04g0110600_circ_g.3 |
| Support reads | 5/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0110600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_003127 zma_circ_003176 |
| PMCS | 0.111358523 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
618767-620178(-) 618814-620185(-) 619884-620178(-) |
| Potential amino acid sequence |
MHLEPFATALGTKRLASEELANEWDNKRLNPGNASYPLSTAGTDNLFGGIEQGAGSSNGQTPYS KFDNGNSIALPSGQVSAMPGLIGKGAKWREGDWMCSNCNNHNYASRAFCNSIRN*(-) MARRRLDVQQLQQSQLCISSLLQQH*(-) MPGLIGKGAKWREGDWMCSNCNNHNYASRAFCNSIRN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |