Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.012G130800_circ_g.1 |
| ID in PlantcircBase | gra_circ_001339 |
| Alias | Chr12:29971732|29972266 |
| Organism | Gossypium raimondii |
| Position | chrChr12: 29971732-29972266 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.012G130800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.012G130800.4:2 Gorai.012G130800.3:2 Gorai.012G130800.5:2 Gorai.012G130800.6:2 Gorai.012G130800.1:1 Gorai.012G130800.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.242445405 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29971738-29971769(+) 29971795-29972251(-) |
| Potential amino acid sequence |
MPEDVTFCGVFDGHGPHGHLVARKVRDALPLKLLSSMDSCQSRQNGSGQTCFKGSLKAADLEKD VSAEERLISLWREAFMKSYKAMDKELRSHPNLDCFCSGSTAVTIVKQGSNLFMGYIGDSRAVMG SKDNNDSMVAIQLTVDLKPDLPRFHAGRCDLLWCI*(+) MTMWTMTIKYTTKGHIFRHEILVNQA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |