Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.007G067100_circ_g.1 |
| ID in PlantcircBase | gra_circ_000702 |
| Alias | Chr07:4741955|4742914 |
| Organism | Gossypium raimondii |
| Position | chrChr07: 4741955-4742914 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.007G067100 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.007G067100.2:2 Gorai.007G067100.3:2 Gorai.007G067100.5:2 Gorai.007G067100.1:2 Gorai.007G067100.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000609 |
| PMCS | 0.121728438 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4742896-4742809(+) 4742011-4742809(+) 4741999-4742832(-) |
| Potential amino acid sequence |
MIMTLRDGTVAACVDVLQITHAAISMVESSSGAVNDIASTMMQKFWDSALSLQPPDDYDTQRWN CCCLCRCSADYSCSNFYG*(+) MVESSSGAVNDIASTMMQKFWDSALSLQPPDDYDTQRWNCCCLCRCSADYSCSNFYG*(+) MSNLQNIYTSSNSSISECHNHLAAVKKGQNPRIFASLCLLCH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |