Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G024800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000314 |
| Alias | Chr04:1911383|1911620 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 1911383-1911620 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G024800 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 15 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G024800.4:2 Gorai.004G024800.10:2 Gorai.004G024800.7:2 Gorai.004G024800.11:2 Gorai.004G024800.5:2 Gorai.004G024800.8:2 Gorai.004G024800.12:2 Gorai.004G024800.3:2 Gorai.004G024800.9:2 Gorai.004G024800.6:2 Gorai.004G024800.2:2 Gorai.004G024800.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000330* gar_circ_000524 |
| PMCS | 0.737866352 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1911386-1911585(-) |
| Potential amino acid sequence |
MQAALVLNASRRFRYTLDLKKEEEKKQILRKIRAHAQAIRAAYLFKQAGEQVNASCTSAQCIPS V*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |