Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0490200_circ_g.2 |
| ID in PlantcircBase | osa_circ_028312 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 24082292-24083786 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os05g0490200 |
| Parent gene annotation |
Protein of unknown function DUF1692 domain containing protein. ( Os05t0490200-01);Similar to serologically defined breast cancer antigen NY-BR-84. (Os05t0490200-02);Similar to cDNA clone:J03307 2O04, full insert sequence. (Os05t0490200-03) |
| Parent gene strand | + |
| Alternative splicing | Os05g0490200_circ_g.1 Os05g0490200_circ_g.3 Os05g0490200_circ_g.4 Os05g0490200_circ_g.5 Os05g0490200_circ_g.6 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0490200-02:5 Os05t0490200-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.137146388 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24082581-24082324(+) 24082299-24082719(-) |
| Potential amino acid sequence |
MDISGEQHHDIRHDIEKRRLDAHGNVIEARKEGIGGAKIESPLQKHGGRLSKGEEYCGTCYGAE ESDEQCCNSCEEVREAYKKKGWALTNPDLIDQGHIFIQQQRLS*(+) MTLVNQIRICKGPSFLLICFPNFFTRITALFIRLLSTITRATVFFTFAESSSMFLQWTLYLCST NAFFSSLNDITMCV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |