Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0116000_circ_g.3 |
ID in PlantcircBase | osa_circ_012749 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 855036-857402 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0116000 |
Parent gene annotation |
Zinc finger, C2H2 domain containing protein. (Os02t0116000-01) |
Parent gene strand | - |
Alternative splicing | Os02g0116000_circ_g.4 Os02g0116000_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0116000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.117453714 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
857263-855074(+) 855248-857388(-) 855052-856827(-) |
Potential amino acid sequence |
MMSNHVSSDETFFGPNNRAKFTLVAPYIPVLCCFNPHVSINIISRAHHVILHVSSSLKHT*(+) MLKHQGKLFTCSMDGCGRKFSIKANMQRHVKEIHEDETATKSNRQFVCKEEGCNKVFKYASKMK KHEESHDVLWR*(-) MKNHMMCSGDDIDGDMRVEATQHRDIRRYKCEFCTVVRSKKCLIRAHMVAHHKEELDKSEIYKS NGEKVVHEGDHTCQECGASFQKPAHLKQHMQSHSDEVGISHMCIQHDIAFLLEWCWD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |