Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d043775_circ_g.5 |
| ID in PlantcircBase | zma_circ_007818 |
| Alias | Zm03circ00097, zma_circ_0001293, GRMZM2G466139_C2 |
| Organism | Zea mays |
| Position | chr3: 209803763-209807034 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d043775 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | Zm00001d043775_circ_g.2 Zm00001d043775_circ_g.3 Zm00001d043775_circ_g.4 Zm00001d043775_circ_g.6 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d043775_T015:7 Zm00001d043775_T013:5 Zm00001d043775_T017:6 Zm00001d043775_T001:7 Zm00001d043775_T009:7 Zm00001d043775_T004:7 Zm00001d043775_T002:7 Zm00001d043775_T005:7 Zm00001d043775_T018:7 Zm00001d043775_T012:5 Zm00001d043775_T006:8 Zm00001d043775_T007:5 Zm00001d043775_T014:8 Zm00001d043775_T010:7 Zm00001d043775_T016:7 Zm00001d043775_T011:6 Zm00001d043775_T008:6 Zm00001d043775_T003:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.028203222 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
209804116-209803784(+) |
| Potential amino acid sequence |
MFTLHTSASRAADGDSFQVTDACTACFEQRTVFTQQVLEKSLNQLVDRIPIPLLFMRTVIQALD AFPALVDFVMGILSRLIDKQIWKMPKLWVGFLKLSFQTQPRSFDVLLQLPPPQLEFMLNKYPNL RTPLSSFVNQRNMHNTLPRYCLYFLG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |