Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0193000_circ_g.8 |
| ID in PlantcircBase | osa_circ_030013 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 4692794-4694808 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0193000 |
| Parent gene annotation |
Similar to Ubiquitin conjugating enzyme 2. (Os06t0193000-01);Sim ilar to ubiquitin-conjugating enzyme E2 J2. (Os06t0193000-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0193000-01:4 Os06t0193000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.102896538 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4693233-4692822(+) 4693264-4692841(+) |
| Potential amino acid sequence |
MVCQHYLQVQNATPICRWAAGEPRSAAAAQSLIDRHILL*(+) MPLQYVVGQRASHDLRRRLSHSLIGIFFCEGQTFR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |