Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0364700_circ_g.1 |
| ID in PlantcircBase | osa_circ_019946 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 14234891-14235225 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0364700 |
| Parent gene annotation |
Transcription elongation factor, TFIIS/CRSP70, N-terminal domain containing protein. (Os03t0364700-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0364700_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0364700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.105970199 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14235039-14234894(+) 14234969-14235019(+) 14234930-14235197(-) |
| Potential amino acid sequence |
MSLPIGKRSSNPSPGHDRGRQLQHMVPGRLRRCILNRNFQKCDLSSNQIPLWLKEDRNQLWLIH *(+) MGQRYDPEQNWKLDQSAMRQSQPYEPSNWQKKQQSVTGARQRPSAAAHGPWTPQKMHLEPKFSE MRPKQQPDTSVAQRRPKPTMADTLEPTAKRARNNIILQTKSLPRSSFPWAKGMIQNKTGSLTSL R*(+) MLLRALFAVGSNVSAIVGFGLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |