Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0149800_circ_g.2 |
| ID in PlantcircBase | osa_circ_026586 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 2847511-2849734 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0149800 |
| Parent gene annotation |
EF-Hand type domain containing protein. (Os05t0149800-01);Simila r to Discordia 1. (Os05t0149800-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0149800_circ_g.3 Os05g0149800_circ_g.4 Os05g0149800_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0149800-01:8 Os05t0149800-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.158274682 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2847739-2847515(+) 2847532-2849472(-) |
| Potential amino acid sequence |
MWVCLRENCVIDDATGAEKMNYEDFCHIATVCTEQIGQKCKRFFSPSNFMKFEKDDSGRIAILP FYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPNLAQLRDMPSAFVQMYCRIAA RKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRICDMFLA LDKDTNGTLSKQELKEYADGTLTDIFIERET*(+) MDPSSGFSFNEDISQCAICIFLELLFAQCSICIFVKCKKHITNALS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |