Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0149800_circ_g.2 |
ID in PlantcircBase | osa_circ_026586 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 2847511-2849734 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0149800 |
Parent gene annotation |
EF-Hand type domain containing protein. (Os05t0149800-01);Simila r to Discordia 1. (Os05t0149800-02) |
Parent gene strand | + |
Alternative splicing | Os05g0149800_circ_g.3 Os05g0149800_circ_g.4 Os05g0149800_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0149800-01:8 Os05t0149800-02:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.158274682 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2847739-2847515(+) 2847532-2849472(-) |
Potential amino acid sequence |
MWVCLRENCVIDDATGAEKMNYEDFCHIATVCTEQIGQKCKRFFSPSNFMKFEKDDSGRIAILP FYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPNLAQLRDMPSAFVQMYCRIAA RKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRICDMFLA LDKDTNGTLSKQELKEYADGTLTDIFIERET*(+) MDPSSGFSFNEDISQCAICIFLELLFAQCSICIFVKCKKHITNALS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |