Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0616900_circ_g.1 |
| ID in PlantcircBase | osa_circ_009812 |
| Alias | Os_ciR7138 |
| Organism | Oryza sativa |
| Position | chr11: 24004217-24005071 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0616900 |
| Parent gene annotation |
Hypothetical gene. (Os11t0616900-01);Hypothetical protein. (Os11 t0616900-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0616900-02:2 Os11t0616900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.204795244 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24004413-24005062(-) |
| Potential amino acid sequence |
MEEQASRSYEMIRFTEYRPSQIHRVVNDRDAIFLGIGSYGSVLQCKIGEKTVAVKIPNNRDSRK PPVQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |