Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0616900_circ_g.1 |
ID in PlantcircBase | osa_circ_009812 |
Alias | Os_ciR7138 |
Organism | Oryza sativa |
Position | chr11: 24004217-24005071 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os11g0616900 |
Parent gene annotation |
Hypothetical gene. (Os11t0616900-01);Hypothetical protein. (Os11 t0616900-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0616900-02:2 Os11t0616900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.204795244 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24004413-24005062(-) |
Potential amino acid sequence |
MEEQASRSYEMIRFTEYRPSQIHRVVNDRDAIFLGIGSYGSVLQCKIGEKTVAVKIPNNRDSRK PPVQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |