Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G32900_circ_g.7 |
ID in PlantcircBase | ath_circ_005491 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 11922815-11922913 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G32900 |
Parent gene annotation |
Granule-bound starch synthase 1, chloroplastic/amyloplastic |
Parent gene strand | - |
Alternative splicing | AT1G32900_circ_g.3 AT1G32900_circ_g.4 AT1G32900_circ_g.5 AT1G32900_circ_g.6 |
Support reads | 10 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G32900.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.367096969 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11922889-11922817(-) 11922833-11922910(+) |
Potential amino acid sequence |
MFVSSIATNEELIVSLLTIQSFLLRSKLGIKLRMFVSSIATNEELIVSLLTIQSFLLRSKLGIK LRMFVSSIATNEELIVSLLTIQSFLLRSKLGIKLRMFVSSIATNEELIVSLLTIQSFLL(-) MVNKDTINSSFVAMEETNILNFIPNFDLSKKDWMVNKDTINSSFVAMEETNILNFIPNFDLSKK DWMVNKDTINSSFVAMEETNILNFIPNFDLSKKDWMVNKDTINSSFVAMEETNILNFIPNFD(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |