Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d044447_circ_g.2 |
| ID in PlantcircBase | zma_circ_007904 |
| Alias | Zm03circ00134 |
| Organism | Zea mays |
| Position | chr3: 228337908-228338327 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d044447 |
| Parent gene annotation |
Carbon catabolite repressor protein 4 homolog 6 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d044447_circ_g.1 Zm00001d044447_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d044447_T004:3 Zm00001d044447_T006:3 Zm00001d044447_T005:3 Zm00001d044447_T007:3 Zm00001d044447_T003:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117460159 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
228338290-228338269(-) |
| Potential amino acid sequence |
MWNDAPVIVCGDFNSTPKSPLYNFMLGQKLNLSGLARNTISGQQIGGSSQGLYTGPNISGSGHF WIKLTLYLRCGMMLQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |