Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.002G094300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000138 |
| Alias | Chr02:11930737|11931299 |
| Organism | Gossypium raimondii |
| Position | chrChr02: 11930737-11931299 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.002G094300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.002G094300.6:1 Gorai.002G094300.9:3 Gorai.002G094300.3:3 Gorai.002G094300.8:3 Gorai.002G094300.2:3 Gorai.002G094300.5:2 Gorai.002G094300.7:2 Gorai.002G094300.1:3 Gorai.002G094300.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.496299452 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11930934-11930995(-) 11930965-11931293(-) 11931267-11931171(+) |
| Potential amino acid sequence |
MKNLICTPDSLMTWTNMWMLLILASGTDKEMNRRKDMVANLRSKANQMASAFNMSNFANRESLL GPETKQDAMSRTVGLDNSGLVGLQRQIMKGK*(-) MSTKHIALAVNEELDLHTRLIDDLDEHVDVTDSRLRNR*(-) MSLRRFISLSVPEARISNIHMFVQVINESGVQIKFFIDRQCNMLCTHYCLFQLLKTLICLSLFV AEDQQDQNYPNQLFYSWHLA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |