Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0674800_circ_g.7 |
ID in PlantcircBase | osa_circ_015959 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 27493777-27493894 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0674800 |
Parent gene annotation |
Similar to OCL1 homeobox protein. (Os02t0674800-01) |
Parent gene strand | - |
Alternative splicing | Os02g0674800_circ_g.6 Os02g0674800_circ_g.8 |
Support reads | 10 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0674800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.560810876 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27493784-27493781(-) |
Potential amino acid sequence |
MKAVQGVPPSGREAARRAQQEALPRCAAGQVLVPESPHADEGCSRSAPIRTRSSAPSSAGGSPS MRGRSSSGSRIAARR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |