Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0130000_circ_g.2 |
| ID in PlantcircBase | osa_circ_029515 |
| Alias | Os06circ02026/Os_ciR2445 |
| Organism | Oryza sativa |
| Position | chr6: 1596188-1596901 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl, find_circ |
| Parent gene | Os06g0130000 |
| Parent gene annotation |
AAA-type ATPase, Defense response (Os06t0130000-01);Similar to T obacco mosaic virus helicase domain-binding protein (Fragment). (Os06t0130000-02);Similar to ATP binding. (Os06t0130000-03) |
| Parent gene strand | + |
| Alternative splicing | Os06g0130000_circ_g.3 |
| Support reads | 5/4 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0130000-03:2 Os06t0130000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006491* osi_circ_016211 |
| PMCS | 0.358832796 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1596837-1596202(+) 1596652-1596194(+) |
| Potential amino acid sequence |
MDAMHVPSHRAGSRSSSTTPPMAYLKA*(+) MIGGGQLVRRRGANHVPDEASVAIAMAAAAGGRLLIRMAHLAPPFAIFRSITEKRKEKKRRGWT QCMCRRTELDLAAAAPHHLWPI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015 |