Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0575000_circ_g.6 |
ID in PlantcircBase | osa_circ_002294 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 22123835-22124458 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0575000 |
Parent gene annotation |
Root hair defective 3 GTP-binding family protein. (Os01t0575000- 01);Root hair defective 3 GTP-binding family protein. (Os01t0575 000-02);Similar to Root hair defective 3 GTP-binding protein. (O s01t0575000-03) |
Parent gene strand | + |
Alternative splicing | Os01g0575000_circ_g.2 Os01g0575000_circ_g.3 Os01g0575000_circ_g.4 Os01g0575000_circ_g.5 Os01g0575000_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0575000-02:4 Os01t0575000-03:4 Os01t0575000-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.208917615 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22124218-22123989(+) 22124252-22123854(+) 22124448-22123989(+) |
Potential amino acid sequence |
MVATVRCEEIGNEKIASFTADEEWQQFEEAVQHDYVPGFGKKISNLLDRCLSESKLWPYLVMRK RRSYSKSRLPV*(+) MRKLPVLQLMRSGNNLRKLFNMITCLGLGRRSATFLTDAYQSRSCGPI*(+) MLIRVEVVALSSYEEKEELFKEQVASLRDRFQQSIAPGGLAGDRRGVVPASGFSFSSQQFWKVI KENKDLDLPAHKVMVATVRCEEIGNEKIASFTADEEWQQFEEAVQHDYVPGFGKKISNLLDRCL SESKLWPYLVMRKRRSYSKSRLPV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |