Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0628400_circ_g.3 |
| ID in PlantcircBase | osa_circ_025459 |
| Alias | Os_ciR9586 |
| Organism | Oryza sativa |
| Position | chr4: 31980438-31980857 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0628400 |
| Parent gene annotation |
Zinc finger, BED-type predicted domain containing protein. (Os04 t0628400-01);Similar to Transposase-related protein b-gary. (Os0 4t0628400-02);Zinc finger, BED-type predicted domain containing protein. (Os04t0628400-03);Zinc finger, BED-type predicted domai n containing protein. (Os04t0628400-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0628400-03:1 Os04t0628400-02:1 Os04t0628400-04:1 Os04t0628400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.198011429 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31980758-31980513(+) 31980595-31980806(-) 31980516-31980847(-) 31980767-31980801(-) |
| Potential amino acid sequence |
MIHSWADLTWGMGGSVQHPQTFWEQTNIKVKPNFAWEVGILLSPLRRFLLARADFLMPP*(+) MGRFSLRSVSTAIIASAAKIPTAQAIYGGIRKSALARRKRRRGDRRIPTSHAKFGLTLMFVCSQ KVWGC*(-) MAASENLPWQGGSGAEATEGFLLPMRNLA*(-) MDHDSLQNTMEHPVPGEEHEEDNSMKVDVAFDGVHSPFRYRHKKRSKVWEEYKPIFLNGKVQFA ECLYCHNRLSCKDSNGTSHLWRHQKICPGKEEAAQRRQKDSYFPCEIWLNLDVCLFPKSLGVLN *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |