Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0857900_circ_g.2 |
| ID in PlantcircBase | osa_circ_004888 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 37078513-37078833 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0857900 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0857900-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0857900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.353266745 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37078582-37078527(+) 37078665-37078804(-) |
| Potential amino acid sequence |
MRLQTSKPLQLAVTEDPSLVFIPCMASIKAYNLWSGMTFQTFRGHYEPVNCCYCSAQEQVLILA *(+) MLAMHGMNTSDGSSVTANCSGLLVCNRIASKLTKVLQPESISQSLKRESELVLVHYSSSN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |