Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0613300_circ_g.4 |
| ID in PlantcircBase | osa_circ_034732 |
| Alias | Os_ciR11089 |
| Organism | Oryza sativa |
| Position | chr7: 25244684-25247206 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0613300 |
| Parent gene annotation |
Similar to PAUSED. (Os07t0613300-01);Similar to PAUSED. (Os07t06 13300-02);Similar to predicted protein. (Os07t0613300-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0613300-01:6 Os07t0613300-03:6 Os07t0613300-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.106447041 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25244728-25247171(-) 25244751-25247167(-) |
| Potential amino acid sequence |
MRKISFPALAAHAFPSDLRNGRALCT*(-) MCCYMKQECVKSLFQLLQLTHFLLISEMVELYVHR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |