Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0636700_circ_g.1 |
| ID in PlantcircBase | osa_circ_031468 |
| Alias | Os06circ14169 |
| Organism | Oryza sativa |
| Position | chr6: 25871067-25871556 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os06g0636700 |
| Parent gene annotation |
Esterase, SGNH hydrolase-type domain containing protein. (Os06t0 636700-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | panicle |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0636700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016450 osi_circ_012616 |
| PMCS | 0.298537857 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25871168-25871552(-) |
| Potential amino acid sequence |
MIAGLQSSLPGLKIAYVPVYDDMLNLINNPSTLGSDPAVEGGGVLQGVPASAPAARRARGGAAD RPRRALRRQHRHQRLPGELLPPRHGAVQAVHRGRVRGLPRRAGGGVPRRHPPPRRAPRRLRRPQ RHRLPAAGAHAQRPPRRLRRGVQPGGQGLQRQAQRHDRRPPELAPRPQDRLRPRLRRHAQPHQQ SFHTWQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |