Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0636700_circ_g.1 |
ID in PlantcircBase | osa_circ_031468 |
Alias | Os06circ14169 |
Organism | Oryza sativa |
Position | chr6: 25871067-25871556 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os06g0636700 |
Parent gene annotation |
Esterase, SGNH hydrolase-type domain containing protein. (Os06t0 636700-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | panicle |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0636700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016450 osi_circ_012616 |
PMCS | 0.298537857 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25871168-25871552(-) |
Potential amino acid sequence |
MIAGLQSSLPGLKIAYVPVYDDMLNLINNPSTLGSDPAVEGGGVLQGVPASAPAARRARGGAAD RPRRALRRQHRHQRLPGELLPPRHGAVQAVHRGRVRGLPRRAGGGVPRRHPPPRRAPRRLRRPQ RHRLPAAGAHAQRPPRRLRRGVQPGGQGLQRQAQRHDRRPPELAPRPQDRLRPRLRRHAQPHQQ SFHTWQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |