Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G25170_circ_g.17 |
| ID in PlantcircBase | ath_circ_014735 |
| Alias | At_ciR868 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 10721510-10722011 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT2G25170 |
| Parent gene annotation |
chromatin remodeling factor CHD3 (PICKLE) |
| Parent gene strand | + |
| Alternative splicing | AT2G25170_circ_g.9 AT2G25170_circ_g.10 AT2G25170_circ_g.11 AT2G25170_circ_g.12 AT2G25170_circ_g.13 AT2G25170_circ_g.14 AT2G25170_circ_g.15 AT2G25170_circ_g.16 AT2G25170_circ_g.18 |
| Support reads | 8 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G25170.1:3 AT2G25170.3:3 AT2G25170.4:3 AT2G25170.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.153003852 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10721533-10722008(+) |
| Potential amino acid sequence |
MEGEGRSFRVLGFNQSQRAIFVQTLMRYGAGNFDWKEFVPRLKQKTFEEINEYGILFLKHIAEE IDENSPTFSDNLEPTPLMEGEGRSFRVLGFNQSQRAIFVQTLMRYGAGNFDWKEFVPRLKQKTF EEINEYGILFLKHIAEEIDENSPTFSDNLEPTPLMEGEGRSFRVLGFNQSQRAIFVQTLMRYGA GNFDWKEFVPRLKQKTFEEINEYGILFLKHIAEEIDENSPTFSDNLEPTPLMEGEGRSFRVLGF NQSQRAIFVQTLMRYGAGNFDWKEFVPRLKQKTFEEINEYGILFLKHIAEEIDENSPTFS(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |