Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA016052_circ_g.11 |
ID in PlantcircBase | osi_circ_005357 |
Alias | 4:9707344|9709020 |
Organism | Oryza sativa ssp. indica |
Position | chr4: 9707344-9709020 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA016052 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA016052_circ_g.1 BGIOSGA016052_circ_g.2 BGIOSGA016052_circ_g.3 BGIOSGA016052_circ_g.4 BGIOSGA016052_circ_g.5 BGIOSGA016052_circ_g.6 BGIOSGA016052_circ_g.7 BGIOSGA016052_circ_g.8 BGIOSGA016052_circ_g.9 BGIOSGA016052_circ_g.10 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA016052-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_023309* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9708728-9707357(+) |
Potential amino acid sequence |
MDYITVCSCWILTLPEKDDAKALTIHTFDPNLTSLVLLSALILIRTFRSLMRCDEKNPLELAGG LTCSIMHTTDSYRG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |