Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0502900_circ_g.1 |
| ID in PlantcircBase | osa_circ_024471 |
| Alias | Os_ciR5429 |
| Organism | Oryza sativa |
| Position | chr4: 25112072-25112451 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0502900 |
| Parent gene annotation |
EF-Hand type domain containing protein. (Os04t0502900-01);Simila r to OSIGBa0112M24.3 protein. (Os04t0502900-02) |
| Parent gene strand | + |
| Alternative splicing | Os04g0502900_circ_g.2 Os04g0502900_circ_g.3 Os04g0502900_circ_g.4 Os04g0502900_circ_g.5 Os04g0502900_circ_g.6 Os04g0502900_circ_g.7 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0502900-01:2 Os04t0502900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.394147763 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25112277-25112132(+) |
| Potential amino acid sequence |
MLPADLMRAVVPVFPPSESNIVREGRLRGERNPGELHCAPSEFFMLFDTNGDRLISFAELVPQK GVLQLRETDTAAQPS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |