Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0639100_circ_g.1 |
| ID in PlantcircBase | osa_circ_031481 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 25970188-25970861 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0639100 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os06 t0639100-01);Similar to protein binding / zinc ion binding. (Os0 6t0639100-02);Similar to protein binding / zinc ion binding. (Os 06t0639100-03);Similar to predicted protein. (Os06t0639100-04);S imilar to predicted protein. (Os06t0639100-05) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0639100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.350693979 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25970767-25970442(+) 25970689-25970791(-) 25970262-25970799(-) |
| Potential amino acid sequence |
MFMHRIINQIPKRIVIWIGRVPQEIKNTIAQYSESPWSSTSDSSATSLLSLALPLPFRLSATCC IIRCSSCGATISRPPCTLSLPALPFQFSCPPFSSCLGSKKSVKPNAQPTAANQ*(+) MRVAPSIFPLDITIFDPFTEIPVDVLLFQICIPFAIEHFKPRATIKALLRHWFAAVGWALGLTD FLLPRHEENGGQENWNGRAGRDRVHGGREMVAPQLEQRMIQHVADNLNGRGNANDSNEVAEESD VDDQGDSEYCAMVFFISCGTLPIQITIRLGI*(-) MAGVMPMTVTRSLKNLMLMTREIQSTAQWCSLFLAGPCRSKLQSV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |