Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0732700_circ_g.1 |
ID in PlantcircBase | osa_circ_016407 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 30546020-30546790 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0732700 |
Parent gene annotation |
Mediator complex, subunit Med23 domain containing protein. (Os02 t0732700-01);Similar to F26F24.8. (Os02t0732700-02);Similar to F 26F24.8. (Os02t0732700-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0732700-03:2 Os02t0732700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.142380826 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30546721-30546125(+) |
Potential amino acid sequence |
MSNGSNSCVQIKKARFVIALESKSVLSLRDGYRGLSEVLLFLEADFLANALENAKCRML*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |