Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0240975_circ_g.2 |
| ID in PlantcircBase | osa_circ_038517 |
| Alias | Os_ciR3241 |
| Organism | Oryza sativa |
| Position | chr9: 3123893-3124019 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os09g0241100 |
| Parent gene annotation |
Similar to nucleotide binding. (Os09t0241100-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0240975_circ_g.1 |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0240975-01:1 Os09t0240975-01:1 Os09t0241100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.403255577 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3123915-3123948(+) 3124018-3123948(+) 3123961-3123897(-) |
| Potential amino acid sequence |
MAALGLDTIALDDEAFNMEAALDRCILRLISSCCNDSKENRRNGCFGSGHDCIR*(+) MIQKKIEEMAALGLDTIALDDEAFNMEAALDRCILRLISSCCNDSKENRRNGCFGSGHDCIR*( +) MLHHLMQSCPDPKQPFLLFSFESLQQLEMSLKMHRSSAASMLNASSSNAIVSRPKAAISSIFF* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |