Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G50500_circ_g.7 |
ID in PlantcircBase | ath_circ_006693 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 18712244-18712564 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G50500 |
Parent gene annotation |
Membrane trafficking VPS53 family protein |
Parent gene strand | - |
Alternative splicing | AT1G50500_circ_g.6 AT1G50500_circ_g.8 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G50500.1:2 AT1G50500.4:2 AT1G50500.3:2 AT1G50500.2:2 AT1G50500.5:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.199713759 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18712486-18712246(-) |
Potential amino acid sequence |
MTLKKLVHGKIIVRIYPKSARNMKRSLLLVKKPRRMVFNRKRPETKIYLLLELGHYKVQWSLKK NLKRNLVVVFLLKILKMTLKKLVHGKIIVRIYPKSARNMKRSLLLVKKPRRMVFNRKRPETKIY LLLELGHYKVQWSLKKNLKRNLVVVFLLKILKMTLKKLVHGKIIVRIYPKSARNMKRSLLLVKK PRRMVFNRKRPETKIYLLLELGHYKVQWSLKKNLKRNLVVVFLLKILKMTLKKLVHGKIIVRIY PKSARNMKRSLLLVKKPRRMVFNRKRPETKIYLLLEL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |