Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc03g096360.2_circ_g.4 |
| ID in PlantcircBase | sly_circ_001078 |
| Alias | 3:51853235|51853463, Slcirc059 |
| Organism | Solanum lycopersicum |
| Position | chr3: 58406632-58406860 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI, circseq_cup |
| Parent gene | Solyc03g096360.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc03g096360.2_circ_g.1 Solyc03g096360.2_circ_g.2 Solyc03g096360.2_circ_g.3 |
| Support reads | 5/34 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc03g096360.2.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.143655814 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
58406690-58406639(+) 58406636-58406803(-) 58406692-58406803(-) |
| Potential amino acid sequence |
MWPANFAPNATIVRVILLCLCLVDVSQPLPKVPVHFFLSVHSLDLNQRSVGILVRFRPLI*(+) MVEIEPVSQHFVDSDRGSEH*(-) METVALLELSSSPICLLNQWSKSNQYPNTSLIQIEGVNTKEEVDWYLGKRLGYIYKAKTKKNNS HYRCIWGKVCRPHGNSGVVRAKFKSNLPPKSMVEIEPVSQHFVDSDRGSEH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Yin et al., 2018; Wang et al., 2018b |