Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G12910_circ_g.5 |
| ID in PlantcircBase | ath_circ_030622 |
| Alias | AT4G12910_C1, AT4G12910_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 7552595-7552817 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT4G12910 |
| Parent gene annotation |
Serine carboxypeptidase-like 20 |
| Parent gene strand | - |
| Alternative splicing | 4_circ_ag.2 AT4G12870_circ_g.1 AT4G12870_circ_g.2 AT4G12910_circ_g.1 AT4G12910_circ_g.2 AT4G12910_circ_g.3 AT4G12910_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G12910.1:1 AT4G12910.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.442826386 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7552698-7552805(-) 7552796-7552805(-) |
| Potential amino acid sequence |
MDGFVYEHGPFNFELPKKNNSLPLLHLNPYSWSKVCDN* MERIYGITLLNRRRIHRKIRWCFGSMVVQVVQAWMDLCMSMVHSISNYQRKTIVSHSCILILIV GPRYVTIDKEHGKNLWYYFIESEKNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKNNS LPLLHLNPYSWSKVCDN* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |