Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G12910_circ_g.5 |
ID in PlantcircBase | ath_circ_030622 |
Alias | AT4G12910_C1, AT4G12910_C1 |
Organism | Arabidpsis thaliana |
Position | chr4: 7552595-7552817 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT4G12910 |
Parent gene annotation |
Serine carboxypeptidase-like 20 |
Parent gene strand | - |
Alternative splicing | 4_circ_ag.2 AT4G12870_circ_g.1 AT4G12870_circ_g.2 AT4G12910_circ_g.1 AT4G12910_circ_g.2 AT4G12910_circ_g.3 AT4G12910_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G12910.1:1 AT4G12910.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.442826386 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7552698-7552805(-) 7552796-7552805(-) |
Potential amino acid sequence |
MDGFVYEHGPFNFELPKKNNSLPLLHLNPYSWSKVCDN* MERIYGITLLNRRRIHRKIRWCFGSMVVQVVQAWMDLCMSMVHSISNYQRKTIVSHSCILILIV GPRYVTIDKEHGKNLWYYFIESEKNPSKDPVVLWLNGGPGCSSMDGFVYEHGPFNFELPKKNNS LPLLHLNPYSWSKVCDN* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |