Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0437900_circ_g.3 |
ID in PlantcircBase | osa_circ_039312 |
Alias | Os_ciR11820 |
Organism | Oryza sativa |
Position | chr9: 16172247-16175285 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os09g0437900 |
Parent gene annotation |
Similar to Adrenodoxin. (Os09t0437900-01) |
Parent gene strand | + |
Alternative splicing | Os09g0437900_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0437900-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.102354653 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16174745-16174690(+) 16175205-16172287(+) 16174780-16175278(-) |
Potential amino acid sequence |
MSMLEAAHENDIELEGACEGSLACSTCHVIVTDVDYYNKLEDPVDEENDMLDLAFGLTETGRLS SVRTQMLHPVIGAASQKLRYL*(+) MLTTTTNWKILWMRRTICWTLHLGLQRREDFLLFEHKCYIQ*(+) MSFSCAASSIDIPIGTLTSFSSPSLSTKVTDILASDSLLLSLDVAFVFEQKKVFPSL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |