Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0748200_circ_g.1 |
| ID in PlantcircBase | osa_circ_021879 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30795266-30795384 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0748200 |
| Parent gene annotation |
Similar to Inhibitor of growth protein 3 (p47ING3 protein). (Os0 3t0748200-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0748200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.635971919 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30795281-30795361(+) |
| Potential amino acid sequence |
MVPLHLCWSDTRNEIQGEMVLPNMQESLMRGSPKLCEGGEWFHYTCVGLTPETRFKGKWFCPTC RNL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |