Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0298500_circ_g.1 |
| ID in PlantcircBase | osa_circ_030603 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 11095727-11096648 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os06g0298500 |
| Parent gene annotation |
SEC-C motif domain containing protein. (Os06t0298500-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0298500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133257972 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11096579-11095742(+) 11095832-11096536(-) 11095768-11096556(-) |
| Potential amino acid sequence |
MCSTSAIVQLQCLVAPILSLFLSFFYIVS*(+) MGSTPLDVGRSNLEKSGQISRNAMCPCGSKKRYKKNSRTATRSVPPSTATARLRMWSTYWPSTH GLRRLRRR*(-) MLCAPVVLRNDIKKTQEQRQDRCHQALQLHDCGCGAHTGQVHMG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |