Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0147700_circ_g.2 |
| ID in PlantcircBase | osa_circ_032766 |
| Alias | Os_ciR3150 |
| Organism | Oryza sativa |
| Position | chr7: 2467152-2467637 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0147700 |
| Parent gene annotation |
ATPase, BadF/BadG/BcrA/BcrD type domain containing protein. (Os 07t0147700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0147700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21494537 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2467566-2467183(+) 2467534-2467160(+) 2467575-2467272(-) |
| Potential amino acid sequence |
MGHWKRSDRLCYQNLSRSLSNTPQAGHMKTNLGRE*(+) MVGKVLMANKRWDIGKEVIDCVTKTYPGAYPIHPKLDI*(+) MSHLLFAMRTLPTITRGKWSFPSSPLNSSLCTTALTLEASSPTELCKILFATSSPASADSTTTG RRSAIRAQDWSSYVQLGVYWIGSWISFGNTIYHFFSNVPSLVCHENFTNHNKRKMVFSIFTAQF KSLHYSLDTGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |