Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0102400_circ_g.1 |
ID in PlantcircBase | osa_circ_012619 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 127903-128004 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0102400 |
Parent gene annotation |
Ribosomal protein S5 family protein. (Os02t0102400-01);Ribosomal protein S5 family protein. (Os02t0102400-02);Ribosomal protein S5 family protein. (Os02t0102400-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0102400-02:1 Os02t0102400-03:1 Os02t0102400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.227128922 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
127985-127905(-) |
Potential amino acid sequence |
MRSGMSAAGRTVETVLYLAGFSNVKSKIYLWPGPMRSGMSAAGRTVETVLYLAGFSNVKSKIYL WPGPMRSGMSAAGRTVETVLYLAGFSNVKSKIYLWPGPMRSGMSAAGRTVETVLYLAGFSNVKS K(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |