Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G18465_circ_g.5 |
ID in PlantcircBase | ath_circ_031568 |
Alias | At_ciR4449 |
Organism | Arabidpsis thaliana |
Position | chr4: 10200629-10201050 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT4G18465 |
Parent gene annotation |
Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEA H9 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G18465.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.211690047 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10200883-10201047(+) |
Potential amino acid sequence |
MKKVVEIRDQLKRIARRLGITLKSCDGDMESVWIIARGVQKEQDEAKLRFAAAEGDHVTFLNVY KGFLESKKPTQWCYKNFLNYQSMKKVVEIRDQLKRIARRLGITLKSCDGDMESVWIIARGVQKE QDEAKLRFAAAEGDHVTFLNVYKGFLESKKPTQWCYKNFLNYQSMKKVVEIRDQLKRIARRLGI TLKSCDGDMESVWIIARGVQKEQDEAKLRFAAAEGDHVTFLNVYKGFLESKKPTQWCYKNFLNY QSMKKVVEIRDQLKRIARRLGITLKSCDGDME(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |