Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0590200_circ_g.2 |
| ID in PlantcircBase | osa_circ_002404 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 23025349-23025883 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0590200 |
| Parent gene annotation |
Conserved hypothetical protein. (Os01t0590200-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0590100_circ_ag.1 Os01g0590100_circ_ag.2 Os01g0590100_circ_ag.3 Os01g0590200_circ_g.1 Os01g0590200_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0590200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111681869 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23025403-23025803(+) 23025839-23025839(-) |
| Potential amino acid sequence |
MSPLPMGGAGWSASSSRGSWQPRSVVGDSDKGGSSVQGMGWESREPQLGGSFFSGDEAITTVGL VALLLSATLSLGKLSPRLRNHHHHYPRRCHLCPWVVPGGRRPRRADRGSLGPSLGIQTRGDRPC KGWAGNPESHN*(+) MASSPEKKDPPSCGSRDSQPIPCTDDPPLSESPTTDLGCHDPRDEDADHPAPPMGKGDIDEDSD DDGYADEETTCPGTGLLRAAAPPAQPW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |