Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G22800_circ_g.1 |
ID in PlantcircBase | ath_circ_003946 |
Alias | AT1G22800_C1, AT1G22800_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 8072307-8072804 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G22800 |
Parent gene annotation |
Putative methyltransferase At1g22800 |
Parent gene strand | + |
Alternative splicing | AT1G22800_circ_g.2 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G05767.1:3 AT1G05767.1:3 AT1G22800.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.277280479 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8072684-8072385(+) 8072724-8072308(+) |
Potential amino acid sequence |
MMDTSYDMIKSCRDAQDDSLDNSIETSYFVGDEEFLPVKESVIERRGFLAKKTILLLTLLQIIY LIA* MLKTIHSITPLKPLTLLVMKSFCQSKRA* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |