Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0271700_circ_g.1 |
| ID in PlantcircBase | osa_circ_011085 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 9916391-9917032 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0271700 |
| Parent gene annotation |
Similar to prenyl transferase. (Os12t0271700-01);Similar to Sola nesyl diphosphate synthase 1. (Os12t0271700-02) |
| Parent gene strand | - |
| Alternative splicing | Os12g0271700_circ_g.2 Os12g0271700_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0271700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.194574104 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9916953-9916495(+) 9916991-9916963(-) |
| Potential amino acid sequence |
MTSSCIKLAVWIISMISAKRWCSVVSSLTDELYNFNIFKVCKKPRRLCKHKITSKYSHPCSI*( +) MIHTASLIHDDVIDDSGMRRGKETIHQLYGTRVAVLAGDFMFAQSSWFLANLENIEVIKLISQG TNYRTPTFGRDHRDDPHCKFNT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |