Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G14590_circ_g.2 |
| ID in PlantcircBase | ath_circ_021771 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 4906695-4906826 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT3G14590 |
| Parent gene annotation |
Calcium-dependent lipid-binding (CaLB domain) family protein |
| Parent gene strand | - |
| Alternative splicing | AT3G14590_circ_g.1 AT3G14590_circ_g.3 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G14590.1:1 AT3G14590.3:1 AT3G14590.5:1 AT3G14590.2:1 AT3G14590.4:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.248839141 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4906812-4906697(-) |
| Potential amino acid sequence |
MNFLTADDMSAILAVKLRKRLGFGMWTKLHLTGMHVEGKVLELGMNFLTADDMSAILAVKLRKR LGFGMWTKLHLTGMHVEGKVLELGMNFLTADDMSAILAVKLRKRLGFGMWTKLHLTGMHVEGKV LELGMNFLTADDMSAILAVKLRKRLGFGMWTKLHLTGMHVEGK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |