Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc08g014150.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_002488 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr8: 3861242-3862899 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI; find_circ |
| Parent gene | Solyc08g014150.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc08g014150.2.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.16618748 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3861510-3861251(+) 3861773-3862898(-) |
| Potential amino acid sequence |
MSQSYIVTFISAGSSSTEKLNSSPHIGFLEPGIIELNLFCVPQVMIAYGSDVPFKLAAIRFLAA NSSTLIMYAELVGGSPFNWPILMN*(+) MIPGSRNPMWGEEFNFSVDELPAEINVTIYDWDIIWKSAVLGSVIVPVENEGQSGAVWHTLNST SGQVCLHIRTVKLNINSSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yang et al., 2020 |