Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d043855_circ_g.2 |
ID in PlantcircBase | zma_circ_007831 |
Alias | Zm03circ00104, GRMZM2G077607_C2 |
Organism | Zea mays |
Position | chr3: 212185811-212186290 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d043855 |
Parent gene annotation |
DUF1639 family protein |
Parent gene strand | + |
Alternative splicing | Zm00001d043855_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d043855_T003:2 Zm00001d043855_T002:1 Zm00001d043855_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.209206143 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
212186279-212185917(+) 212185876-212185864(+) 212185878-212185955(-) |
Potential amino acid sequence |
MREEGPSRIDQAGRSGRRRTRRIGPPWMASTTITTTKSRR*(+) MDGVYHHHHHQESPLTGNGVATAGEKLGVERFELPLIYISLSRKEKEDDFLAMKGTKLPQRPKK RAKNVDKTLQFVFPGMWLSDLTRGRYEVREKKCVKKDRRGSIRRAEAVVAGQDA*(+) MVDLCVLSGDDRFCPPDRSSTVLLHAFLLPHLVPSPRQIGQPHTREDKLEGLVHVLSPFLGPLG QLGALHRKEIVFLLLPRQRDVDQRQLEPLHA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |