Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G10640_circ_g.4 |
| ID in PlantcircBase | ath_circ_020896 |
| Alias | Ath_circ_FC1901 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3324259-3324610 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT3G10640 |
| Parent gene annotation |
Vacuolar protein sorting-associated protein 60.1 |
| Parent gene strand | - |
| Alternative splicing | AT3G10640_circ_g.1 AT3G10640_circ_g.2 AT3G10640_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G10640.1:2 AT3G10640.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.273978259 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3324485-3324261(-) |
| Potential amino acid sequence |
MRVLKQKKMYEGQRDMLYNQTFNLDQVSFAAEGLKDAQQTINKRGDSVEDKIKKLDVELCKYKE QLKKTRPGPAQEAVKARAMRVLKQKKMYEGQRDMLYNQTFNLDQVSFAAEGLKDAQQTINKRGD SVEDKIKKLDVELCKYKEQLKKTRPGPAQEAVKARAMRVLKQKKMYEGQRDMLYNQTFNLDQVS FAAEGLKDAQQTINKRGDSVEDKIKKLDVELCKYKEQLKKTRPGPAQEAVKARAMRVLKQKKMY EGQRDMLYNQTFNLDQVSFAAEGLKDAQQT(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |