Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G53180_circ_g.12 |
| ID in PlantcircBase | ath_circ_027281 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr3: 19710299-19710487 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, circRNA_finder |
| Parent gene | AT3G53180 |
| Parent gene annotation |
Nodulin/glutamine synthase-like protein |
| Parent gene strand | + |
| Alternative splicing | AT3G53180_circ_g.11 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G53180.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.490740916 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19710426-19710484(+) |
| Potential amino acid sequence |
MAGVLFHLPSILAIIAPLPNRYDYCDIGSGSHVHLSLWKNGENVFPASNNSSSHGISSVGEEFM AGVLFHLPSILAIIAPLPNRYDYCDIGSGSHVHLSLWKNGENVFPASNNSSSHGISSVGEEFMA GVLFHLPSILAIIAPLPNRYDYCDIGSGSHVHLSLWKNGENVFPASNNSSSHGISSVGEEFMAG VLFHLPSILAIIAPLPN(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |